| request information: |
|
| Catalog Code: | H00008312-M01 |
| Product Name: | AXIN1 Antibody |
| Product Description: | Mouse Monoclonal anti-AXIN1 (2B11) |
| Clone: | 2B11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8312 |
| Gene Symbol: | AXIN1 |
| Immunogen: | AXIN1 (NP_003493, 643 a.a. ~ 741 a.a) partial recombinant protein with GST tag. |
| Epitope: | ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRA
SRAPSKQRYVQEVMRRGRA* |
| Specificity: | AXIN1 - axin 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin (cadherin-associated protein), beta 1, 88kDa, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AXIN1 antibody, anti-AXIN antibody, anti-MGC52315 antibody, anti-axin 1 antibody, anti-axis inhibitor 1 antibody, anti-fused antibody, anti-mouse antibody, anti-homolog of antibody, anti-axis inhibition protein 1 Official Gene Symbol - AXIN1GenBank Accession Number ? NP_003493 antibody, anti-NP_851393 LocusLink ID - 8312 (human) antibody, anti-12005 (mouse) antibody, anti-79257 (rat)Gene Ontology terms - signal transducer activity antibody, anti-oocyte axis determination antibody, anti-frizzled receptor signaling pathway antibody, anti-development antibody, anti-apoptosis antibody, anti-cytoplasm antibody, anti-negative regulation of cell cycle antibody, anti-Axis Inhibitor 1 antibody, anti-MGC52315 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|