| request information: |
|
| Catalog Code: | H00008309-A01 |
| Product Name: | ACOX2 Antibody |
| Product Description: | Mouse Polyclonal anti-ACOX2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8309 |
| Gene Symbol: | ACOX2 |
| Omim ID: | 601641 |
| Immunogen: | ACOX2 (NP_003491, 582 a.a. ~ 682 a.a) partial recombinant protein with GST tag. |
| Epitope: | HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNT
QENPAYEEYIRPLLQSWRSKL* |
| Specificity: | ACOX2 - acyl-Coenzyme A oxidase 2, branched chain |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | The product of this gene belongs to the acyl-CoA oxidases family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation and death in children. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BCOX antibody, anti-BRCACOX antibody, anti-BRCOX antibody, anti-THCCox antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |