| request information: |
|
| Catalog Code: | H00008292-A01 |
| Product Name: | collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase Antibody |
| Product Description: | Mouse Polyclonal anti-collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8292 |
| Gene Symbol: | COLQ |
| Omim ID: | 603033, 603034, |
| Immunogen: | COLQ (NP_005668, 356 a.a. ~ 456 a.a) partial recombinant protein with GST tag. |
| Epitope: | PIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGS
YGDLQCTQYCYIDSTPCRYFT* |
| Specificity: | collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | This gene encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in this gene are associated with endplate acetylcholinesterase deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EAD antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |