ExactAntigen

ARID1A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008289-M01
Product Type:Primary Antibody
Product Name:ARID1A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8289
Host:Mouse
Clone:3H2
Isotype:IgG Mix Kappa
Product Description:Mouse Monoclonal anti-ARID1A (3H2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = ARID1A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-B120 antibody, anti-BAF250 antibody, anti-BM029 antibody, anti-C1orf4 antibody, anti-P270 antibody, anti-SMARCF1 antibody
Immunogen:ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag.
Epitope:NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP* ...
Specificity:ARID1A - AT rich interactive domain 1A (SWI- like)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ARID1A
Omim ID:603024
see all human ARID1A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about