ExactAntigen

ubiquitin-like 4A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008266-M02
Product Type:Primary Antibody
Product Name:ubiquitin-like 4A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8266
Host:Mouse
Clone:1C10
Isotype:IgM Kappa
Product Description:Mouse Monoclonal anti-ubiquitin-like 4A (1C10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is BC043346. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-DXS254E antibody, anti-GDX antibody, anti-UBL4 antibody
Immunogen:UBL4A (AAH43346, 1 a.a. ~ 158 a.a) full length recombinant protein with GST tag.
Epitope:MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK* ...
Specificity:ubiquitin-like 4A
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:UBL4A
Omim ID:312070,
see all human UBL4A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about