| request information: |
|
| Catalog Code: | H00008239-M01 |
| Product Name: | USP9X Antibody |
| Product Description: | Mouse Monoclonal anti-USP9X (1C4) |
| Clone: | 1C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8239 |
| Gene Symbol: | USP9X |
| Omim ID: | 300072, |
| Immunogen: | USP9X (NP_068706, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTATTRGSPVGGNDNQGQAPDGQSLPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMI
NRPRWVVPVLP* |
| Specificity: | USP9X - ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-DFFRX antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |