ExactAntigen

RP13-297E16.1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008227-M02
Product Type:Primary Antibody
Product Name:RP13-297E16.1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8227
Host:Mouse
Clone:2G8
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-RP13-297E16.1 (2G8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = RP13-297E16.1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-721P antibody, anti-DXYS155E antibody, anti-MGC125365 antibody, anti-MGC125366 antibody, anti-MGC39904 antibody, anti-XE7 antibody, anti-XE7Y antibody
Immunogen:RP13-297E16.1 (NP_005079, 53 a.a. ~ 157 a.a) partial recombinant protein with GST tag.
Epitope:ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC* ...
Specificity:RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence, isoform 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RP13-297E16.1
Omim ID:312095, 465000,
see all human XE7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about