| request information: |
|
| Catalog Code: | H00008204-A01 |
| Product Name: | NRIP1 Antibody |
| Product Description: | Mouse Polyclonal anti-NRIP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8204 |
| Gene Symbol: | NRIP1 |
| Omim ID: | 602490, |
| Immunogen: | NRIP1 (NP_003480, 1051 a.a. ~ 1159 a.a) partial recombinant protein with GST tag. |
| Epitope: | KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHM
GNNASRPHSANGEVYGLLGSVLTIKKESE* |
| Specificity: | NRIP1 - nuclear receptor interacting protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Nuclear receptor interacting protein 1 (NRIP1) is a nuclear protein that specifically interacts with the hormone-dependent activation domain AF2 of nuclear receptors. Also known as RIP140, this protein modulates transcriptional activity of the estrogen receptor. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RIP140 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |