| request information: |
|
| Catalog Code: | H00008189-M03 |
| Product Name: | SYMPK Antibody |
| Product Description: | Mouse Monoclonal anti-SYMPK (4C2) |
| Clone: | 4C2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8189 |
| Gene Symbol: | SYMPK |
| Omim ID: | 602388, |
| Immunogen: | SYMPK (AAH30214, 1 a.a. ~ 534 a.a) full length recombinant protein with GST tag. |
| Epitope: | MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQ AALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADK SIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVV KKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDI ILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHD ISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVH |
| Specificity: | SYMPK - symplekin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Cytoplasm, cytoskeleton. Cell junction, adherens junction; Cytoplasmic side. Cell junction; Cytoplasmic side. Nucleus, nucleoplasm. Note=Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without TJ). Nuclear bodies of heat-stressed cells. |
| Background: | This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Symplekin antibody, anti-FLJ27092 antibody, anti-SPK antibody, anti-SYM antibody, anti-SYMPK antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |