| request information: |
|
| Catalog Code: | H00008170-M01 |
| Product Name: | SLC14A2 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC14A2 (3E7) |
| Clone: | 3E7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8170 |
| Gene Symbol: | SLC14A2 |
| Omim ID: | 601611, |
| Immunogen: | SLC14A2 (NP_009094, 40 a.a. ~ 129 a.a) partial recombinant protein with GST tag. |
| Epitope: | ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQF
IDWVLRGTAQ* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration mechanism. Thus, the plasma membrane of erythrocytes and some renal epithelial cells exhibit an elevated urea permeability that is mediated by highly selective urea transporters. In mammals, 2 urea transporters have been identified: the renal tubular urea transporter, UT2, and the erythrocyte urea transporter, UT11 (SLC14A1; MIM 111000).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HUT2 antibody, anti-MGC119566 antibody, anti-MGC119567 antibody, anti-UT-A2 antibody, anti-UT2 antibody, anti-UTR antibody, anti-hUT-A6 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |