| CatalogCode: | | H00008170-A01 |
| ProductName: | | solute carrier family 14 (urea transporter), member 2 Antibody |
| Product Description: | | Mouse Polyclonal anti-solute carrier family 14 (urea transporter), member 2 |
| Clonality: | | Polyclonal |
| Immunogen: | | SLC14A2 (NP_009094, 40 a.a. ~ 129 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ* ... |
| Specificity: | | solute carrier family 14 (urea transporter), member 2 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera Other applications have not been tested. |
| Background: | | In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration mechanism. Thus, the plasma membrane of erythrocytes and some renal epithelial cells exhibit an elevated urea permeability that is mediated by highly selective urea transporters. In mammals, 2 urea transporters have been identified: the renal tubular urea transporter, UT2, and the erythrocyte urea transporter, UT11 (SLC14A1; MIM 111000).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HUT2 antibody, anti-MGC119566 antibody, anti-MGC119567 antibody, anti-UT-A2 antibody, anti-UT2 antibody, anti-UTR antibody, anti-hUT-A6 antibody |
| ProteinTarget: | | solute carrier family 14 (urea transporter), member 2 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 8170 |
| Gene_Symbol: | | SLC14A2 |
| Omim_ID: | | 601611, |
| more information: | | company product webpage |