| CatalogCode: | H00008128-M01 |
| ProductName: | ST8SIA2 Antibody |
| Product Description: | Mouse Monoclonal anti-ST8SIA2 (6G6) |
| Clone: | 6G6 |
| Clonality: | Monoclonal |
| Immunogen: | ST8SIA2 (NP_006002, 40 a.a. ~ 147 a.a) partial recombinant protein with GST tag. |
| Epitope: | TIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRT* ... |
| Specificity: | ST8SIA2 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HsT19690 antibody, anti-MGC116854 antibody, anti-SIAT8B antibody, anti-ST8SIA-II antibody, anti-STX antibody |
| ProteinTarget: | ST8SIA2 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8128 |
| Gene_Symbol: | ST8SIA2 |
| Omim_ID: | 602546, |
order or
more information: | company product webpage |
| request information: |
|