| request information: |
|
| Catalog Code: | H00008125-M01 |
| Product Name: | ANP32A Antibody |
| Product Description: | Mouse Monoclonal anti-ANP32A (2G11-4A5) |
| Clone: | 2G11-4A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8125 |
| Gene Symbol: | ANP32A |
| Omim ID: | 600832 |
| Immunogen: | ANP32A (AAH07200, 1 a.a. ~ 250 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGG
LEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDS
DAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKR
KREPEDEGEDDD* |
| Specificity: | ANP32A - acidic (leucine-rich) nuclear phosphoprotein 32 family, member A |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C15orf1 antibody, anti-I1PP2A antibody, anti-LANP antibody, anti-MAPM antibody, anti-PHAP1 antibody, anti-PHAPI antibody, anti-PP32 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |