| request information: |
|
| Catalog Code: | H00008100-A01 |
| Product Name: | intraflagellar transport 88 homolog Antibody |
| Product Description: | Mouse Polyclonal anti-intraflagellar transport 88 homolog |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8100 |
| Gene Symbol: | IFT88 |
| Omim ID: | 600595, |
| Immunogen: | IFT88 (NP_783195, 724 a.a. ~ 834 a.a) partial recombinant protein with GST tag. |
| Epitope: | RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLG
PQIERPKTAAKKRIDEDDFADEELGDDLLPE* |
| Specificity: | intraflagellar transport 88 homolog (Chlamydomonas) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | This gene encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D13S1056E antibody, anti-MGC26259 antibody, anti-RP11-172H24.2 antibody, anti-TG737 antibody, anti-TTC10 antibody, anti-hTg737 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |