| request information: |
|
| Catalog Code: | H00008086-M02 |
| Product Name: | AAAS Antibody |
| Product Description: | Mouse Monoclonal anti-AAAS (5A1) |
| Clone: | 5A1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8086 |
| Gene Symbol: | AAAS |
| Omim ID: | 231550, 605378, |
| Immunogen: | AAAS (NP_056480, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKR
CINIWRDVGLFGVLNEIANSE* |
| Specificity: | AAAS - achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AAA antibody, anti-AAASb antibody, anti-ADRACALA antibody, anti-ADRACALIN antibody, anti-DKFZp586G1624 antibody, anti-GL003 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |