| request information: | |
| Catalog Code: | H00008031-M01 |
| Product Name: | NCOA4 Antibody |
| Product Description: | Mouse Monoclonal anti-NCOA4 (2H8) |
| Clone: | 2H8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8031 |
| Gene Symbol: | NCOA4 |
| Omim ID: | 188550 601984 |
| Immunogen: | NCOA4 (AAH12736, 1 a.a. ~ 576 a.a) full length recombinant protein with GST tag. |
| Epitope: | MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQ LKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLK TIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENS QTSSRACNFFNNVGGNLK |
| Specificity: | NCOA4 - nuclear receptor coactivator 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-ARA70 antibody, anti-DKFZp762E1112 antibody, anti-ELE1 antibody, anti-PTC3 antibody, anti-RFG antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |