| request information: |
|
| Catalog Code: | H00008027-M01 |
| Product Name: | STAM Antibody |
| Product Description: | Mouse Monoclonal anti-STAM (2B11-1G1) |
| Clone: | 2B11-1G1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8027 |
| Gene Symbol: | STAM |
| Omim ID: | 601899, |
| Immunogen: | STAM (AAH30586, 1 a.a. ~ 404 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTG PKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEV CSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLS LISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVA NKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDP |
| Specificity: | STAM - signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Signal transducing adaptor molecule antibody, anti-STAM1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |