| request information: |
|
| Catalog Code: | H00008013-M02 |
| Product Name: | NR4A3 Antibody |
| Product Description: | Mouse Monoclonal anti-NR4A3 - nuclear receptor subfamily 4, group A, member 3 (1E9) |
| Clone: | 1E9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8013 |
| Gene Symbol: | NR4A3 |
| Immunogen: | NR4A3 (NP_008912, 414 a.a. ~ 522 a.a) partial recombinant protein with GST tag. |
| Epitope: | LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDK
FVFCNGLVLHRLQCLRGFGEWLDSIKDFS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Four transcript variants encoding three distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CHN antibody, anti-CSMF antibody, anti-MINOR antibody, anti-NOR1 antibody, anti-TEC antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |