| request information: |
|
| Catalog Code: | H00007941-M02 |
| Product Name: | PLA2G7 Antibody |
| Product Description: | Mouse Monoclonal anti-PLA2G7 (5D1) |
| Clone: | 5D1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7941 |
| Gene Symbol: | PLA2G7 |
| Omim ID: | 147050, 600807, 601690, |
| Immunogen: | PLA2G7 (AAH38452, 22 a.a. ~ 442 a.a) full length recombinant protein with GST tag. |
| Epitope: | FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPY SVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFW GLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLV VFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYY FKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQ ALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREK |
| Specificity: | PLA2G7 - phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Localization: | Redistributes to axons during neuronal development. Also localizes to the microtubules of the manchette in elongating spermatids and to the meiotic spindle in spermatocytes (By similarity). Cytoplasm. Localizes to the plus end of microtubules and to the centrosome. May localize to the nuclear membrane. |
| Background: | The PLA2G7 gene encodes platelet-activating factor (PAF) acetylhydrolase (EC 3.1.1.47), a secreted enzyme that catalyzes the degradation of PAF to inactive products by hydrolysis of the acetyl group at the sn-2 position, producing the biologically inactive products LYSO-PAF and acetate.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-LDL-PLA2 antibody, anti-LIS1 antibody, anti-LIS 1 antibody, anti-LIS 2 antibody, anti-LIS2 antibody, anti-Lissencephaly 1 protein antibody, anti-MDCR antibody, anti-PAF acetylhydrolase 45 kDa subunit antibody, anti-PAF AH 45 kDa subunit antibody, anti-PAF AH alpha antibody, anti-PAFAH alpha antibody, anti-PAFAH antibody, anti-PAFAH1B1 antibody, anti-PAFAHA antibody, anti-Platelet activating factor acetylhydrolase isoform Ib alpha subunit antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |