| request information: |
|
| Catalog Code: | H00007920-A01 |
| Product Name: | BAT5 Antibody |
| Product Description: | Mouse Polyclonal anti-BAT5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7920 |
| Gene Symbol: | BAT5 |
| Omim ID: | 142620 |
| Immunogen: | BAT5 (NP_066983, 459 a.a. ~ 557 a.a) partial recombinant protein with GST tag. |
| Epitope: | PRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLH
NFEATHCTPLPAQNFQMPW* |
| Specificity: | BAT5 - HLA-B associated transcript 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D6S82E antibody, anti-NG26 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |