| request information: |
|
| Catalog Code: | H00007884-M01 |
| Product Name: | SLBP Antibody |
| Product Description: | Mouse Monoclonal anti-SLBP (2C4-1C8) |
| Clone: | 2C4-1C8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7884 |
| Gene Symbol: | SLBP |
| Omim ID: | 602422 |
| Immunogen: | SLBP (AAH14908, 1 a.a. ~ 271 a.a) full length recombinant protein with GST tag. |
| Epitope: | MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRSRCSDWASAV
EEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEV
PRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSG
TPTKVRHMDSQVEDEFDL |
| Specificity: | SLBP - stem-loop (histone) binding protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HBP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |