| request information: |
|
| Catalog Code: | H00007844-A01 |
| Product Name: | RNF103 Antibody |
| Product Description: | Mouse Polyclonal anti-RNF103 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7844 |
| Gene Symbol: | RNF103 |
| Omim ID: | 602507 |
| Immunogen: | RNF103 (NP_005658, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag. |
| Epitope: | HPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSESENTDTLSSEKEVFEDKQSVLHNSPGTASHCDAEACSCA
NKYCQTSPCERKGRSYGSYN* |
| Specificity: | RNF103 - ring finger protein 103 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KF1 antibody, anti-MGC102815 antibody, anti-MGC41857 antibody, anti-ZFP103 antibody, anti-hkf-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |