| request information: |
|
| Catalog Code: | H00007832-M01 |
| Product Name: | BTG2 Antibody |
| Product Description: | Mouse Monoclonal anti-BTG2 (1A5) |
| Clone: | 1A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7832 |
| Gene Symbol: | BTG2 |
| Omim ID: | 601597 |
| Immunogen: | BTG2 (NP_006754, 59 a.a. ~ 159 a.a) partial recombinant protein with GST tag. |
| Epitope: | PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSEL TLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVL LGRSSPSKNYVMAVSS* |
| Specificity: | BTG2 - BTG family, member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC126063 antibody, anti-MGC126064 antibody, anti-PC3 antibody, anti-TIS21 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |