| request information: |
|
| Catalog Code: | H00007812-A01 |
| Product Name: | CSDE1 Antibody |
| Product Description: | Mouse Polyclonal anti-CSDE1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7812 |
| Gene Symbol: | CSDE1 |
| Omim ID: | 191510, |
| Immunogen: | CSDE1 (NP_009089, 670 a.a. ~ 766 a.a) partial recombinant protein with GST tag. |
| Epitope: | HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGP
DNSMGFGAERKIRQAGV* |
| Specificity: | CSDE1 - cold shock domain containing E1, RNA-binding |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D1S155E antibody, anti-DKFZp779B0247 antibody, anti-DKFZp779J1455 antibody, anti-RP5-1000E10.3 antibody, anti-UNR antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |