| Catalog Code: | H00007803-B01 |
| Product Type: | Primary Antibody |
| Product Name: | PTP4A1 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 7803 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-PTP4A1 - protein tyrosine phosphatase type IVA, member 1, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs), which contains a PTP domain and a characteristic C-terminal prenylation motif. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This tyrosine phosphatase is a nuclear protein, but may primarily associate with plasma membrane. The surface membrane association of this protein depends on its C-terminal prenylation. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which implicated its role in the tumorigenesis. Studies in rat suggested that this gene may be an immediate-early gene in mitogen-stimulated cells. |
| Alternate Names: | anti-DKFZp779M0721 antibody, anti-HH72 antibody, anti-PRL-1 antibody, anti-PRL1 antibody, anti-PTP(CAAX1) antibody, anti-PTPCAAX1 antibody |
| Immunogen: | PTP4A1 (-, 1 a.a. ~ 173 a.a) full-length human protein. |
| Epitope: | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |