ExactAntigen

PTP4A1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007803-B01
Product Type:Primary Antibody
Product Name:PTP4A1 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:7803
Host:Mouse
Product Description:Mouse Polyclonal anti-PTP4A1 - protein tyrosine phosphatase type IVA, member 1, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs), which contains a PTP domain and a characteristic C-terminal prenylation motif. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This tyrosine phosphatase is a nuclear protein, but may primarily associate with plasma membrane. The surface membrane association of this protein depends on its C-terminal prenylation. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which implicated its role in the tumorigenesis. Studies in rat suggested that this gene may be an immediate-early gene in mitogen-stimulated cells.
Alternate Names:anti-DKFZp779M0721 antibody, anti-HH72 antibody, anti-PRL-1 antibody, anti-PRL1 antibody, anti-PTP(CAAX1) antibody, anti-PTPCAAX1 antibody
Immunogen:PTP4A1 (-, 1 a.a. ~ 173 a.a) full-length human protein.
Epitope:MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human PRL 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about