| request information: |
|
| Catalog Code: | H00007727-M01 |
| Product Name: | ZNF174 Antibody |
| Product Description: | Mouse Monoclonal anti-ZNF174 (3E4) |
| Clone: | 3E4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7727 |
| Gene Symbol: | ZNF174 |
| Omim ID: | 603900 |
| Immunogen: | ZNF174 (AAH00876, 1 a.a. ~ 235 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDP ELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQ ILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHR ASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRR DLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEL LIEKTDPNMATDELPCKLWLSFIA* |
| Specificity: | ZNF174 - zinc finger protein 174 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Localization: | Nuclear |
| Background: | ZNF174 is a transcriptional repressor. Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and HEPG2 cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate Buffered Saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AW1 antibody, anti-Zinc finger and SCAN domain containing protein 8 antibody, anti-Zinc finger protein 174 antibody, anti-ZSCAN8 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |