| Catalog Code: | H00007711-A01 |
| Product Type: | Primary Antibody |
| Product Name: | zinc finger protein 155 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 7711 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-zinc finger protein 155 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-pHZ-96 antibody |
| Immunogen: | ZNF155 (NP_003436, 422 a.a. ~ 520 a.a) partial recombinant protein with GST tag. |
| Epitope: | HSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRR* ... |
| Specificity: | zinc finger protein 155 (pHZ-96) |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther appl |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug). |
| Gene Symbol: | ZNF155 |
| Omim ID: | 604086, |