| request information: |
|
| Catalog Code: | H00007690-A01 |
| Product Name: | ZNF131 Antibody |
| Product Description: | Mouse Polyclonal anti-ZNF131 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7690 |
| Gene Symbol: | ZNF131 |
| Omim ID: | 604073 |
| Immunogen: | ZNF131 (AAH35875, 139 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
| Epitope: | TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVC
QYCEKQFDHFGHFKEHLRKHT* |
| Specificity: | ZNF131 - zinc finger protein 131 (clone pHZ-10) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-pHZ-10 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | Nuclear Trafficking of the POZ-ZF Protein Znf131. Nickett S. Donaldsona, Juliet M. Daniel et al. Biochimica et Biophysica Acta (BBA) - Molecular Cell Research, In Press, Accepted Manuscript, Available online 15 December 2006. |
order or
more information: | company product webpage |