| request information: |
|
| Catalog Code: | H00007639-M06 |
| Product Name: | zinc finger protein 85 Antibody |
| Product Description: | Mouse Monoclonal anti-zinc finger protein 85 (3C1) |
| Clone: | 3C1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7639 |
| Gene Symbol: | ZNF85 |
| Omim ID: | 603899, |
| Immunogen: | ZNF85 (NP_003420, 2 a.a. ~ 77 a.a) partial recombinant protein with GST tag. |
| Epitope: | GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT* |
| Specificity: | zinc finger protein 85 (HPF4, HTF1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HPF4 antibody, anti-HTF1 antibody, anti-MGC78566 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |