| request information: |
|
| Catalog Code: | H00007639-A01 |
| Product Name: | ZNF85 Antibody |
| Product Description: | Mouse Polyclonal anti-ZNF85 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7639 |
| Gene Symbol: | ZNF85 |
| Omim ID: | 603899 |
| Immunogen: | ZNF85 (NP_003420, 2 a.a. ~ 77 a.a) partial recombinant protein with GST tag. |
| Epitope: | GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT* |
| Specificity: | ZNF85 - zinc finger protein 85 (HPF4, HTF1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HPF4 antibody, anti-HTF1 antibody, anti-MGC78566 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |