ExactAntigen

ZBTB25 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007597-B01
Product Type:Primary Antibody
Product Name:ZBTB25 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:7597
Host:Mouse
Product Description:Mouse Polyclonal anti-ZBTB25 - zinc finger and BTB domain containing 25, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Alternate Names:anti-KUP antibody, anti-ZNF46 antibody
Immunogen:ZBTB25 (-, 1 a.a. ~ 435 a.a) full-length human protein.
Epitope:MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSECIKIQPTDIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSPETVQSSNLYGIQISTTQKTVVKQGLEVKEAPSSNSGNRAAVQGDHPQLQLSLAIGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLRQ ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human KUP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about