| request information: | |
| Catalog Code: | H00007579-M02 |
| Product Name: | ZNF31 Antibody |
| Product Description: | Mouse Monoclonal anti-ZNF31 (3G7) |
| Clone: | 3G7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7579 |
| Gene Symbol: | ZNF31 |
| Immunogen: | ZNF31 (AAH11404, 1 a.a. ~ 434 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEASRQRFRQFQYRDAAGPHEAFSQLWALCCRW LRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGEEAVALVEDWHRETRTAGQSGLELHTEETRPLKTGEEAQ SFQLQPVDPWPEGQSQKKGVKNTCPDLPNHLNAEVAPQPLKESGVPVSKPSNTSEKEQGPEFWGLSLINSGKRSTADYS LDNEPAQALTWRDSRAWE |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KOX29 antibody, anti-ZFP-31 antibody, anti-ZNF360 antibody, anti-ZSCAN20 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or more information: | company product webpage |