| request information: |
|
| Catalog Code: | H00007561-A01 |
| Product Name: | zinc finger protein 14 Antibody |
| Product Description: | Mouse Polyclonal anti-zinc finger protein 14 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7561 |
| Gene Symbol: | ZNF14 |
| Omim ID: | 194556, |
| Immunogen: | ZNF14 (NP_066358, 70 a.a. ~ 162 a.a) partial recombinant protein with GST tag. |
| Epitope: | RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGK
TFSYHHCFRKHER* |
| Specificity: | zinc finger protein 14 (KOX 6) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GIOT-4 antibody, anti-KOX6 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |