| request information: |
|
| Catalog Code: | H00007545-M03 |
| Product Name: | ZIC1 Antibody |
| Product Description: | Mouse Monoclonal anti-ZIC1 (4D11) |
| Clone: | 4D11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7545 |
| Gene Symbol: | ZIC1 |
| Omim ID: | 600470, |
| Immunogen: | ZIC1 (NP_003403, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Epitope: | LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHH
HHPGHVGSYSSAAFN* |
| Specificity: | ZIC1 - Zic family member 1 (odd-paired homolog, Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate Buffered Saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Odd paired homolog Drosophila antibody, anti-Zic 1 antibody, anti-ZIC antibody, anti-Zic family member 1 (odd-paired Drosophila homolog) antibody, anti-Zic family member 1 antibody, anti-Zinc finger protein of the cerebellum 1 antibody, anti-Zinc finger protein ZIC 1 antibody, anti-Zinc finger protein ZIC1 antibody, anti-ZNF 201 antibody, anti-ZNF201 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |