ExactAntigen

YWHAZ Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007534-B01
Product Type:Primary Antibody
Product Name:YWHAZ Antibody
List Price:295
Clonality:Polyclonal
Gene ID:7534
Host:Mouse
Product Description:Mouse Polyclonal anti-YWHAZ - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to th
Alternate Names:anti-KCIP-1 antibody, anti-MGC111427 antibody, anti-MGC126532 antibody, anti-MGC138156 antibody
Immunogen:YWHAZ (NP_003397, 1 a.a. ~ 245 a.a) full-length human protein.
Epitope:MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human YWHAZ antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about