| Catalog Code: | H00007534-B01 |
| Product Type: | Primary Antibody |
| Product Name: | YWHAZ Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 7534 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-YWHAZ - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to th |
| Alternate Names: | anti-KCIP-1 antibody, anti-MGC111427 antibody, anti-MGC126532 antibody, anti-MGC138156 antibody |
| Immunogen: | YWHAZ (NP_003397, 1 a.a. ~ 245 a.a) full-length human protein. |
| Epitope: | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |