ExactAntigen

Mouse Monoclonal anti-YWHAH (6A12)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00007533-M04
ProductName:YWHAH Antibody
Product Description:Mouse Monoclonal anti-YWHAH (6A12)
Clone:6A12
Clonality:Monoclonal
Immunogen:YWHAH (AAH03047, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Epitope:MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP ...
Specificity:YWHAH - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-YWHA1 antibody
ProteinTarget:YWHAH - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:7533
Gene_Symbol:YWHAH
Omim_ID:113508,
see all human YWHAH antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about