| request information: |
|
| Catalog Code: | H00007532-M01 |
| Product Name: | YWHAG Antibody |
| Product Description: | Mouse Monoclonal anti-YWHAG (3G3) |
| Clone: | 3G3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7532 |
| Gene Symbol: | YWHAG |
| Omim ID: | 605356 |
| Immunogen: | YWHAG (NP_036611, 67 a.a. ~ 167 a.a) partial recombinant protein with GST tag. |
| Epitope: | EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRAT
VVESSEKAYSEAHEISKEHMQ* |
| Specificity: | YWHAG - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a lambda |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-14-3-3GAMMA antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |