ExactAntigen

Mouse Monoclonal anti-YY1 (4D2) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00007528-M03
ProductName: YY1 Antibody
Product Description: Mouse Monoclonal anti-YY1 (4D2)
Clone: 4D2
Clonality: Monoclonal
Immunogen: YY1 (NP_003394, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag.
Epitope: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH* ...
Specificity: YY1 - YY1 transcription factor
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background: YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB, IHC-P
SpeciesSummary: Hu
ALTnames: anti-DELTA antibody, anti-NF-E1 antibody, anti-UCRBP antibody, anti-YIN-YANG-1 antibody
ProteinTarget: YY1 - YY1 transcription factor
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 7528
Gene_Symbol: YY1
Omim_ID: 600013,
more information: company product webpage
Also see:
see all human YY1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about