| request information: |
|
| Catalog Code: | H00007528-M02 |
| Product Name: | YY1 Antibody |
| Product Description: | Mouse Monoclonal anti-YY1 (4A5) |
| Clone: | 4A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7528 |
| Gene Symbol: | YY1 |
| Omim ID: | 600013, |
| Immunogen: | YY1 (NP_003394, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. |
| Epitope: | VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACP
HKGCTKMFRDNSAMRKHLHTH* |
| Specificity: | YY1 - YY1 transcription factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DELTA antibody, anti-NF-E1 antibody, anti-UCRBP antibody, anti-YIN-YANG-1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |