ExactAntigen

YES1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007525-M02
Product Type:Primary Antibody
Product Name:YES1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:7525
Host:Mouse
Clone:3C6
Isotype:IgG2b kappa
Product Description:Mouse Monoclonal anti-YES1 (3C6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = YES1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-HsT441 antibody, anti-P61-YES antibody, anti-Yes antibody, anti-c-yes antibody
Immunogen:YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
Epitope:MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV ...
Specificity:YES1 - v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:YES1
Omim ID:164880
see all human YES1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about