| request information: |
|
| Catalog Code: | H00007525-A01 |
| Product Name: | YES1 Antibody |
| Product Description: | Mouse Polyclonal anti-YES1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7525 |
| Gene Symbol: | YES1 |
| Omim ID: | 164880 |
| Immunogen: | YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFS
V |
| Specificity: | YES1 - v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HsT441 antibody, anti-P61-YES antibody, anti-Yes antibody, anti-c-yes antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |