| request information: |
|
| Catalog Code: | H00007520-M02 |
| Product Name: | XRCC5 Antibody |
| Product Description: | Mouse Monoclonal anti-XRCC5 (3D8) |
| Clone: | 3D8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7520 |
| Gene Symbol: | XRCC5 |
| Omim ID: | 194364 |
| Immunogen: | XRCC5 (AAH19027, 1 a.a. ~ 733 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFV QRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLM LPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKK FEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFS LGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKM VMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSI |
| Specificity: | XRCC5 - X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Nuclear |
| Background: | The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Ku80 antibody, anti-86 kDa subunit of Ku antigen antibody, anti-ATP dependent DNA helicase 2 subunit 2 antibody, anti-ATP dependent DNA helicase II 80 kDa subunit antibody, anti-ATP dependent DNA helicase II 86 Kd subunit antibody, anti-ATP dependent DNA helicase II antibody, anti-CTC box binding factor 85 kDa antibody, anti-CTC85 antibody, anti-CTCBF antibody, anti-DNA repair protein XRCC5 antibody, anti-Double strand break rejoining antibody, anti-FLJ39089 antibody, anti-G22P2 antibody, anti-KARP 1 antibody, anti-KARP1 antibody, anti-Ku 80 antibody, anti-Ku autoantigen 80kDa antibody, anti-Ku86 antibody, anti-Ku86 autoantigen related protein 1 antibody, anti-KUB 2 antibody, anti-KUB2 antibody, anti-Lupus Ku autoantigen protein p86 antibody, anti-NFIV antibody, anti-Nuclear factor IV antibody, anti-Thyroid lupus autoantigen antibody, anti-TLAA antibody, anti-Xray repair complementing defective repair in Chinese hamster cells 5 antibody, anti-XRCC 5 antibody, anti-XRCC5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|