| request information: |
|
| Catalog Code: | H00007515-A01 |
| Product Name: | XRCC1 Antibody |
| Product Description: | Mouse Polyclonal anti-XRCC1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7515 |
| Gene Symbol: | XRCC1 |
| Omim ID: | 194360 |
| Immunogen: | XRCC1 (NP_006288, 534 a.a. ~ 634 a.a) partial recombinant protein with GST tag. |
| Epitope: | LPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWI
YSCNEKQKLLPHQLYGVVPQA* |
| Specificity: | XRCC1 - X-ray repair complementing defective repair in Chinese hamster cells 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RCC antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |