| Catalog Code: | H00007494-M04 |
| Product Type: | Primary Antibody |
| Product Name: | XBP1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 7494 |
| Host: | Mouse |
| Clone: | 4E4 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-XBP1 - X-box binding protein 1 (4E4) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhance |
| Alternate Names: | anti-TREB5 antibody, anti-XBP2 antibody |
| Immunogen: | XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
| Epitope: | THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | XBP1 |