| CatalogCode: | H00007494-M01 |
| ProductType: | Primary Antibody |
| ProductName: | XBP1 Antibody |
| ListPrice: | 295 |
| Clonality: | Monoclonal |
| Gene_Id: | 7494 |
| Host: | Mouse |
| Clone: | 3F5 |
| Isotype: | IgG2a Kappa |
| ProductDescription: | Mouse Monoclonal anti-XBP1 - X-box binding protein 1, (3F5) |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhance |
| ALTnames: | anti-TREB5 antibody, anti-XBP2 antibody |
| Immunogen: | XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | This antibody works for Western Blot and ELISA. |
| AppSummary: | ELISA, WB |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |