| Catalog Code: | H00007490-M01 |
| Product Type: | Primary Antibody |
| Product Name: | WT1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 7490 |
| Host: | Mouse |
| Clone: | 2H4 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-WT1 (2H4) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is muta |
| Alternate Names: | anti-GUD antibody, anti-WAGR antibody, anti-WIT-2 antibody, anti-WT33 antibody |
| Immunogen: | WT1 (NP_000369, 349 a.a. ~ 439 a.a) full length recombinant protein with GST tag. |
| Epitope: | QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | WT1 |
| Omim ID: | 136680, 194070, 194072, 194080, 256370, 607102, |