ExactAntigen

WT1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007490-M01
Product Type:Primary Antibody
Product Name:WT1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:7490
Host:Mouse
Clone:2H4
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-WT1 (2H4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is muta
Alternate Names:anti-GUD antibody, anti-WAGR antibody, anti-WIT-2 antibody, anti-WT33 antibody
Immunogen:WT1 (NP_000369, 349 a.a. ~ 439 a.a) full length recombinant protein with GST tag.
Epitope:QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:WT1
Omim ID:136680, 194070, 194072, 194080, 256370, 607102,
see all human WT1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about