| request information: |
|
| Catalog Code: | H00007461-A01 |
| Product Name: | cytoplasmic linker 2 Antibody |
| Product Description: | Mouse Polyclonal anti-cytoplasmic linker 2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7461 |
| Gene Symbol: | CYLN2 |
| Omim ID: | 603432, |
| Immunogen: | CYLN2 (NP_003379, 946 a.a. ~ 1047 a.a) partial recombinant protein with GST tag. |
| Epitope: | LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTI
GNSGSANGIHQQDKAQKQEDKH* |
| Specificity: | cytoplasmic linker 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CLIP antibody, anti-CLIP-115 antibody, anti-CLIP2 antibody, anti-KIAA0291 antibody, anti-MGC11333 antibody, anti-WBSCR4 antibody, anti-WSCR4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |