| request information: | |
| Catalog Code: | H00007443-M02 |
| Product Name: | VRK1 Antibody |
| Product Description: | Mouse Monoclonal anti-VRK1 (4F9) |
| Clone: | 4F9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7443 |
| Gene Symbol: | VRK1 |
| Omim ID: | 602168, |
| Immunogen: | VRK1 (NP_003375, 287 a.a. ~ 397 a.a) partial recombinant protein with GST tag. |
| Epitope: | DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEES KEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK* |
| Specificity: | VRK1 - vaccinia related kinase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Background: | This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu , |
| Alternate Names: | anti-MGC117401 antibody, anti-MGC138280 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |