ExactAntigen

VRK1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007443-A01
Product Type:Primary Antibody
Product Name:VRK1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:7443
Host:Mouse
Product Description:Mouse Polyclonal anti-VRK1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal live
Alternate Names:anti-MGC117401 antibody, anti-MGC138280 antibody
Immunogen:VRK1 (NP_003375, 287 a.a. ~ 397 a.a) partial recombinant protein with GST tag.
Epitope:DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK* ...
Specificity:VRK1 - vaccinia related kinase 1
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:VRK1
Omim ID:602168
see all human vaccinia related kinase 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about