| request information: |
|
| Catalog Code: | H00007434-A01 |
| Product Name: | VIPR2 Antibody |
| Product Description: | Mouse Polyclonal anti-VIPR2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7434 |
| Gene Symbol: | VIPR2 |
| Omim ID: | 601970 |
| Immunogen: | VIPR2 (NP_003373, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. |
| Epitope: | ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETF
PDFVDACGYSDPEDESKITFYILV* |
| Specificity: | VIPR2 - vasoactive intestinal peptide receptor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Vasoactive intestinal peptide (VIP; MIM 192320) and pituitary adenylate cyclase activating polypeptide (PACAP; MIM 102980) are homologous peptides that function as neurotransmitters and neuroendocrine hormones. While the receptors for VIP and PACAP share homology, they differ in their substrate specificities and expression patterns. See VIPR1 (MIM 192321) and ADCYAP1R1(MIM 102981).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ16511 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |